PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g110320.1
Common NameMTR_7g110320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 1002aa    MW: 110602 Da    PI: 6.285
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g110320.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1283.7e-40145221278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      Cqve+C+adl++ak+yhrrhkvCe+hska+++lv + +qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Medtr7g110320.1 145 CQVEDCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTNQ 221
                      **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.8E-33137206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.992142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.2E-37143223IPR004333Transcription factor, SBP-box
PfamPF031107.3E-29145218IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.5E-6301327IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484036.5E-7760887IPR020683Ankyrin repeat-containing domain
CDDcd002043.62E-6775886No hitNo description
Gene3DG3DSA:1.25.40.202.5E-6775889IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1002 aa     Download sequence    Send to blast
MEAFQLYGNG GGSSDLRAMG KNSKEWDLNN WKWDSHLFIA TSKLTPVPEH RQFLPIPVGG  60
GGGGGGSNSN SSSSCSEQLD LGICQVKEGE RKRRVIVVED ELGLGLNKEG GNLSLNLGGG  120
VATWEGNNGK KSRVAGGGSS SRAFCQVEDC RADLNNAKDY HRRHKVCEIH SKASKALVGN  180
AMQRFCQQCS RFHLLQEFDE GKRSCRRRLA GHNKRRRKTN QDAVPNGSSP NDDQTSSYLL  240
ISLLKILSNM QPDRSNQTAD QDLLTHLLRS LANQNGEQGG RNLSNLLREP ENLLKEGSLS  300
GKSEMVSTLV TNGSQGSPTV TVQNQTVSIS EIQHQVMHSH DARVADQQTT FSAKPGVSNS  360
PPAYSEARDS TAGQTKMNDF DLNDIYIDSD DGIEDIERLP VTTNLGASSL DYPWMQQDSH  420
QSSPPQTSGN SDSASAQSPS SSTGETQNRT DRIVFKLFGK GPGDFPLVLK AQILDWLSHS  480
PTDIEGYIRP GCVVLTIYLR QAEVVWEELC FDLTSSLNRL LGVSDDDFWR TGWVHIRVQH  540
QMAFIFNGQI VIDTPLPFRS NNYGKILSVS PIAIPSSKTA QFSVKGINLT RPATRLLCAL  600
EGNYLDCEDT DEPMDQCSKD LDELQCIQFS CSVPAMNGRG FIEIEDQGLS SSFFPFIVVE  660
EDVCSEICVL EPLLESSDTY PDNEGAGKIQ AKNQAMDFIH EMGWLLHRRQ IKSSVRLNSS  720
MDLFPLDRFK WLMEFSVDHD WCAVVKKLLN LMLDGTVSTG DHTSLYLALS ELGLLHRAVR  780
RNSRQLVELL LRFVPQNISD KLGPEDKALV NGENQNFLFR PDAVGPAGLT PLHIAAGKDG  840
SEDVLDALTN DPCMVGIEAW NSARDSTGST PEDYARLRGH YTYIHLVQKK INKSQGGAHV  900
VVDIPSIPTK FDTSQKKDES CTTFQIGNAE VKKVRKDCKL CDHKLSCRTA VRKSFVYRPA  960
MLSMVAIAAV CVCVALLFKS SPEVLYIFRP FRWESLDYGT S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31138218484squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.19640.0glandular trichome| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626036.20.0squamosa promoter-binding-like protein
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLG7KUJ20.0G7KUJ2_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA02G01160.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]